Mascot Search Results

User            : 
Email           : 
Search title    : MS/MS Example
Database        : SwissProt 2014_04 (544996 sequences; 193815432 residues)
Timestamp       : 20 May 2014 at 11:00:46 GMT
Protein hits    : CH60_HUMAN 60 kDa heat shock protein, mitochondrial OS=Homo sapiens GN=HSPD1 PE=1 SV=2
  CH60_CAEEL Chaperonin homolog Hsp-60, mitochondrial OS=Caenorhabditis elegans GN=hsp-60 PE=1 SV=2

Mascot Score Histogram

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 41 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Display non-significant matches Show sub-sets
  Show pop-ups  Suppress pop-ups  Sort unassigned Require bold red
  Preferred taxonomy 

        Error tolerant   

1.    CH60_HUMAN    Mass: 61016    Score: 1176   Matches: 27(27)  Sequences: 17(17)
 60 kDa heat shock protein, mitochondrial OS=Homo sapiens GN=HSPD1 PE=1 SV=2
Check to include this hit in error tolerant search or archive report
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique  Peptide
11   417.1822   832.3498   832.3828   -0.0329 0  45  0.03 1       K.APGFGDNR.K
12   422.7433   843.4720   843.5066   -0.0346 0  46  0.035 1  U    K.VGEVIVTK.D
15   451.2499   900.4853   900.5280   -0.0428 0  52  0.008 1  U    K.LSDGVAVLK.V
16   456.7806   911.5467   911.5804   -0.0337 0  59  0.0011 1  U    K.VGLQVVAVK.A
21   480.7447   959.4748   959.5036   -0.0288 0  45  0.035 1  U    R.VTDALNATR.A
24   595.7855   1189.5565   1189.6012   -0.0447 0  (57) 0.0022 1  U    K.EIGNIISDAMK.K
25   603.7720   1205.5294   1205.5962   -0.0668 0  60  0.001 1  U    K.EIGNIISDAMK.K + Oxidation (M)
26   608.3099   1214.6052   1214.6507   -0.0455 0  73  4.6e-005 1  U    K.NAGVEGSLIVEK.I
27   617.2857   1232.5569   1232.5885   -0.0316 0  81  8.5e-006 1  U    K.VGGTSDVEVNEK.K
31   672.8375   1343.6605   1343.7085   -0.0480 0  64  0.00033 1  U    R.TVIIEQSWGSPK.V
34   714.8884   1427.7623   1427.8058   -0.0435 0  (65) 0.00029 1  U    R.GVMLAVDAVIAELK.K
35   714.8938   1427.7730   1427.8058   -0.0327 0  (73) 4.4e-005 1  U    R.GVMLAVDAVIAELK.K
36   722.8849   1443.7552   1443.8007   -0.0455 0  75  2.5e-005 1  U    R.GVMLAVDAVIAELK.K + Oxidation (M)
37   722.8934   1443.7722   1443.8007   -0.0285 0  (73) 4.5e-005 1  U    R.GVMLAVDAVIAELK.K + Oxidation (M)
39   752.8643   1503.7141   1503.7490   -0.0349 0  90  8.9e-007 1  U    K.TLNDELEIIEGMK.F
40   760.8461   1519.6777   1519.7439   -0.0662 0  (89) 1e-006 1  U    K.TLNDELEIIEGMK.F + Oxidation (M)
45   640.3281   1917.9625   1918.0636   -0.1010 0  102  4.3e-008 1  U    K.ISSIQSIVPALEIANAHR.K
46   960.0327   1918.0509   1918.0636   -0.0127 0  (87) 1.1e-006 1  U    K.ISSIQSIVPALEIANAHR.K
48   1019.5106   2037.0067   2037.0153   -0.0087 0  52  0.0031 1  U    R.IQEIIEQLDVTTSEYEK.E
51   1057.0537   2112.0929   2112.1323   -0.0394 0  116  1.4e-009 1  U    R.ALMLQGVDLLADAVAVTMGPK.G
52   1065.0399   2128.0653   2128.1272   -0.0619 0  (72) 3.7e-005 1  U    R.ALMLQGVDLLADAVAVTMGPK.G + Oxidation (M)
54   1073.0477   2144.0809   2144.1221   -0.0412 0  (93) 2.8e-007 1  U    R.ALMLQGVDLLADAVAVTMGPK.G + 2 Oxidation (M)
58   789.1062   2364.2968   2364.3264   -0.0296 0  (56) 0.0011 1  U    R.KPLVIIAEDVDGEALSTLVLNR.L
59   1183.1570   2364.2994   2364.3264   -0.0270 0  (65) 0.00011 1  U    R.KPLVIIAEDVDGEALSTLVLNR.L
60   789.1094   2364.3063   2364.3264   -0.0201 0  95  1.3e-007 1  U    R.KPLVIIAEDVDGEALSTLVLNR.L
62   828.1322   2481.3748   2481.3942   -0.0194 0  48  0.0064 1  U    R.TALLDAAGVASLLTTAEVVVTEIPK.E
64   854.0588   2559.1545   2559.2413   -0.0868 0  75  1.1e-005 1  U    K.LVQDVANNTNEEAGDGTTTATVLAR.S

2.    CH60_CAEEL    Mass: 60064    Score: 135    Matches: 3(3)  Sequences: 2(2)
 Chaperonin homolog Hsp-60, mitochondrial OS=Caenorhabditis elegans GN=hsp-60 PE=1 SV=2
Check to include this hit in error tolerant search or archive report
      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique  Peptide
 11   417.1822   832.3498   832.3828   -0.0329 0  45  0.03 1       K.APGFGDNR.K
 39   752.8643   1503.7141   1503.7490   -0.0349 0  90  8.9e-007 1  U    K.TLNDELELIEGMK.F
 40   760.8461   1519.6777   1519.7439   -0.0662 0  (89) 1e-006 1  U    K.TLNDELELIEGMK.F + Oxidation (M)

Peptide matches not assigned to protein hits: (no details means no match)

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique  Peptide
13   430.7328   859.4510   859.4837   -0.0327 0  36  0.31 1       IPAMTIAK + Oxidation (M)
33   714.3649   1426.7153   1426.8143   -0.0990 1  31  0.67 1       EASPLSSNKLILR
14   442.2283   882.4421   882.6014   -0.1594 1  28  1.1 1       IAIRGLLK
61   828.1238   2481.3495   2481.3942   -0.0447 0  26  0.89 1       TALLDAAGVASLLTTAEVVVTEIPK
53   1065.0623   2128.1100   2128.1272   -0.0172 0  26  1.3 1       ALMLQGVDLLADAVAVTMGPK + Oxidation (M)
22   1101.5366   1100.5293   1100.6441   -0.1148 0  14  38 1       ITVSTSGLVPK
9   747.3962   746.3889   746.3446   0.0443 0  14  24 1       DAEDVAK
65   1038.5031   3112.4873   3112.5023   -0.0150 0  13  14 1       DMAIATGGAVFGEEGLTLNLEDVQPHDLGK + Oxidation (M)
23   1101.6217   1100.6144   1100.6012   0.0132 0  12  65 1       QLLMVAGVDR
8   714.3725   713.3652   713.4072   -0.0419 0  11  17 1       LAPAQSK
4   662.2756   661.2683   661.3217   -0.0534 0  10  5.1 1       AGNAVCK
30   663.8379   1325.6612   1325.7666   -0.1054 1  10  94 1       AQLLEINEKLR
57   747.0361   2238.0864   2238.0562   0.0302 1  9  63 1       AMWRLVDEMVQDGFPTTAR + Oxidation (M)
55   1099.0947   2196.1749   2196.1862   -0.0113 1  8  77 1       LNAEAVRTLLSANGQKPSEAK
29   642.3536   1282.6926   1282.7357   -0.0431 0  8  1.4e+002 1       VVGVAGQGASALVR
6   673.3495   672.3422   672.3919   -0.0497 0  8  26 1       AVLGGTR
28   642.3526   1282.6906   1282.6630   0.0277 1  7  1.6e+002 1       KNVSVSQGPDPR
38   749.3840   1496.7534   1496.7001   0.0532 1  7  1.5e+002 1       QSTMQRSAAGTSTR + Oxidation (M)
50   1048.5615   2095.1085   2095.0659   0.0426 1  6  1.5e+002 1       ALDEILEYQNYPVVCAKK
49   1020.9879   2039.9613   2040.0640   -0.1027 1  5  1.6e+002 1       VEPPGDKTLKPGPGAHSPEK
19   932.3644   931.3571   931.4004   -0.0433 0  5  3.7e+002 1       MHNLMDR + Oxidation (M)
20   933.4990   932.4917   932.4498   0.0419 1  3  5.8e+002 1       SRDPGMVR + Oxidation (M)
47   665.0096   1992.0069   1991.9662   0.0407 1  2  3.6e+002 1       QTLQVFKYYLMDENGK + Oxidation (M)
41   886.4059   1770.7972   1770.8822   -0.0850 0  2  4.1e+002 1       AGLELADSPVTPEMLGR + Oxidation (M)
18   930.7030   929.6957   929.5042   0.1915 1  2  4.6e+002 1       ASRAQLER
7   711.3647   710.3574   710.3711   -0.0137 0  1  67 1       GGAHEIK
32   711.3707   1420.7269   1420.6517   0.0752 1  1  6.2e+002 1       DKAIGYTSCGNHR
17   930.6831   929.6758   929.5545   0.1213 1  1  7e+002 1       KIQAEITK
44   949.5507   1897.0869   1897.0071   0.0798 1  1  4.2e+002 1       LAARWLAEHPHAPSSVR
43   933.0038   1863.9930   1863.9553   0.0377 1  1  5.3e+002 1       ISATCVPSAVQKWFAEK
1   498.2729   497.2656         
2   500.2560   499.2487         
3   575.5584   574.5511         
5   662.4172   661.4099         
10   747.4125   746.4052         
42   932.4608   1862.9071         
56   1119.0452   2236.0758         
63   832.7986   2495.3739         
66   1113.8947   3338.6621         
67   1116.1775   3345.5106         

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : Trypsin
Variable modifications : Oxidation (M)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 0.2 Da
Fragment Mass Tolerance: ± 0.2 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-QUAD-TOF
Number of queries      : 67
Top scoring peptide matches to query 1
Score greater than 13 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
Top scoring peptide matches to query 2
Score greater than 13 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
Top scoring peptide matches to query 3
Score greater than 13 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
Top scoring peptide matches to query 4
Score greater than 21 indicates homology
Score greater than 29 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
9.7 5.1 -0.0534 R.AGNAVCK.V
9.7 5.1 -0.0712 K.KAGGSDK.I
9.7 5.1 -0.0898 R.KGGAVCK.D
7.9 7.7 -0.0712 R.SLGGGGSK.S
7.4 8.8 -0.0712 R.KDSGAGK.F
6.4 11 -0.0824 K.KAGGSSR.N
6.0 12 -0.0712 M.ATASQGK.V
4.4 17 -0.1076 R.XAAKGSK.L
4.1 18 -0.0534 K.LANGGCK.Q
4.1 19 -0.0712 R.EGKGGSK.G
Top scoring peptide matches to query 5
Score greater than 29 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
Top scoring peptide matches to query 6
Score greater than 17 indicates homology
Score greater than 34 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
7.6 26 -0.0497 R.AVLGGTR.N
7.6 26 -0.0497 R.AVLSGAR.D
4.5 53 -0.0133 K.GIGAAER.V
4.5 53 -0.0133 K.GLAGAER.A
3.1 72 -0.0497 GIISAGR
2.8 78 -0.0133 M.AVPGSSR.R
2.4 86 -0.0133 K.AVDGGVR.R
1.2 1.1e+002 -0.0133 K.AGLKNGN.-
0.3 1.4e+002 -0.0133 R.AAAADVR.A
0.3 1.4e+002 -0.0496 M.AAAATLR.L
Top scoring peptide matches to query 7
Score greater than 13 indicates homology
Score greater than 32 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
1.3 67 -0.0137 R.GGAHEIK.S
Top scoring peptide matches to query 8
Score greater than 19 indicates homology
Score greater than 36 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
10.7 17 -0.0419 K.LAPAQSK.K
6.3 47 -0.0419 K.LAPASQK.G
4.4 73 -0.0783 K.ALNVVAK.K
2.2 1.2e+002 -0.0783 LAPKASK
1.7 1.4e+002 -0.0896 R.ALLGRGK.A
1.3 1.5e+002 -0.0783 K.IIAGVNK.L
0.9 1.6e+002 -0.0896 K.AIRGAVK.N
0.9 1.6e+002 -0.0896 R.ALGRAVK.L
0.9 1.6e+002 -0.0783 K.ALVNAVK.L
0.9 1.6e+002 -0.0783 K.LAVNVAK.Q
Top scoring peptide matches to query 9
Score greater than 25 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
13.6 24 0.0443 DAEDVAK
13.6 24 0.0079 K.VSEDVAK.K
13.2 26 0.0144 R.APMGLSR.E
12.0 34 0.0079 R.EVSDVAK.M
11.5 39 -0.0285 R.DVTTIAK.G
11.5 39 -0.0649 R.ITTTLAK.A
11.5 39 -0.0649 K.LTTTIAK.E
11.5 39 -0.0649 K.TLTTLAK.I
11.2 41 -0.0285 K.ESVTIAK.E
11.0 43 -0.0285 R.EVSTALK.I
Top scoring peptide matches to query 10
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
Top scoring peptide matches to query 11
Score greater than 38 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
45.4 0.03 -0.0329 1+ CH60_HUMAN APGFGDNR
22.4 5.9 -0.1057 K.APGFRTGK.V
14.2 39 -0.0329 R.ANFDPNR.V
11.3 76 0.0001 K.APMNNDR.R
10.4 94 -0.1268 K.ATVTAKSR.G
10.4 95 0.0001 K.ANAPSCDR.L
10.1 1e+002 -0.0727 K.APGSSRMK.T
9.5 1.1e+002 -0.0653 K.AGGSSKNGR.D
8.8 1.4e+002 -0.0801 K.APVLMMR.M
8.8 1.4e+002 -0.0801 K.APVMIMR.D
Top scoring peptide matches to query 12
Score greater than 40 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
45.7 0.035 -0.0346 1 CH60_HUMAN K.VGEVIVTK.D
25.0 4.1 -0.0094 R.VGEIVTAR.I
22.0 8.3 0.0019 R.ADVLAEVK.A
20.4 12 -0.0346 K.VGDILTVK.V
19.1 16 -0.0458 K.ERVLTVK.V
17.8 22 -0.0458 K.RDLIVTK.S
17.3 24 -0.0458 R.VERLVTK.V
17.3 24 -0.0458 R.RLDLVTK.S
16.9 27 -0.0458 K.ERLVTVK.E
16.2 31 -0.0094 K.REIVEAK.Q
Top scoring peptide matches to query 13
Score greater than 36 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
36.3 0.31 -0.0327 K.IPAMTIAK.N
21.0 10 -0.0116 K.LPAWVMK.G
17.1 26 -0.0253 R.LDSKAQAK.L
15.1 40 0.0037 R.IPGLMEGK.V
14.2 50 -0.0405 K.IPFERAK.V
11.8 87 0.0111 K.AEDAKAQK.E
11.8 87 -0.0253 K.TVDQAAKK.I
11.6 90 0.0275 K.HHCHKAK.L
11.1 1e+002 -0.0253 R.LDSAKAAGK.N
11.1 1e+002 -0.0075 -.MAPKAAAGK.K
Top scoring peptide matches to query 14
Score greater than 39 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
28.5 1.1 -0.1594 R.IAIRGLLK.L
25.1 2.4 -0.1118 K.LIAQTPLK.D
17.6 13 -0.0866 K.LLARGPEK.C
17.0 15 -0.0866 R.LARIADPK.M
17.0 15 -0.1118 K.KDPLLGLK.E
16.9 16 -0.0754 R.GIAVLADPK.G
16.0 19 -0.1594 R.IARLLGIK.K
16.0 19 -0.1482 R.ILNLLGLK.K
15.5 22 -0.1230 R.IRPSIGLK.R
15.3 23 -0.1594 K.LLRAGLIK.L
Top scoring peptide matches to query 15
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
52.0 0.008 -0.0428 1 CH60_HUMAN K.LSDGVAVLK.V
33.9 0.52 -0.0791 K.LSATGLVLK.-
28.7 1.7 -0.0063 R.EAAEAAVLK.A
28.2 1.9 -0.0428 K.INSDVLLK.N
24.2 4.8 -0.0428 R.QVSDVILK.D
23.8 5.2 -0.1155 K.ISISKLLK.L
23.4 5.8 -0.0427 M.AEISAALVK.E
22.6 6.9 -0.0427 K.EALSVAALK.H
22.1 7.7 -0.0614 K.IGGLMAVLK.W
21.7 8.4 -0.0428 K.LDNSVILK.G
Top scoring peptide matches to query 16
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
59.0 0.0011 -0.0337 1 CH60_HUMAN VGLQVVAVK
42.2 0.053 -0.0701 R.GIVKVVAVK.A
37.2 0.17 -0.0086 R.VAAGVAVVAR.G
34.8 0.29 -0.0337 R.VAQVLGVVK.G
28.1 1.4 -0.0337 R.GILNVVAVK.A
27.5 1.6 -0.0337 K.VGLVAGAVVK.T
27.3 1.6 -0.0450 K.GVIRAVAVK.A
25.6 2.4 -0.0086 R.VQAVVAVAR.E
24.6 3.1 -0.0198 K.VAQVIRAR.N
23.5 3.9 0.0026 K.VAQVLPTGK.L
Top scoring peptide matches to query 17
Score greater than 13 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
1.0 7e+002 0.1213 R.KIQAEITK.I
0.3 8.2e+002 0.1828 R.AVQAAESVR.S
Top scoring peptide matches to query 18
Score greater than 14 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
1.6 4.6e+002 0.1915 K.ASRAQLER.G
1.6 4.6e+002 0.1663 M.LGSGIKAER.L
1.6 4.6e+002 0.1663 R.SVKQLAER.R
1.4 4.9e+002 0.1510 R.FGVKVQPR.S
0.6 5.9e+002 0.1663 R.AGASVIKER.I
0.6 5.9e+002 0.1663 R.ALAAATKER.D
0.6 5.9e+002 0.1623 R.ALGWAKVVS.-
0.6 5.9e+002 0.1915 R.ARLGTQER.V
0.6 5.9e+002 0.1915 R.ASSRPKER.R
0.6 5.9e+002 0.1510 K.FGVKPGLGR.M
Top scoring peptide matches to query 19
Score greater than 17 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
4.6 3.7e+002 -0.0433 K.MHNLMDR.Y
4.6 3.7e+002 -0.0875 K.MRAHFDR.A
4.1 4.2e+002 -0.1087 K.TGMTRNPR.F
3.7 4.5e+002 -0.1556 R.VTVPVFDR.Y
1.7 7.3e+002 -0.1338 K.GEVQICKR.F
1.4 7.8e+002 -0.1338 K.QREIQMK.Q
1.4 7.8e+002 -0.1768 K.VSQVLTTGK.L
0.8 9e+002 -0.1403 K.GEVIQATSK.F
0.2 1e+003 -0.1403 R.NLGEITSAK.E
0.2 1e+003 -0.1305 K.QGNPVYVR.H
Top scoring peptide matches to query 20
Score greater than 15 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
3.2 5.8e+002 0.0419 R.SRDPGMVR.S
3.1 5.9e+002 0.0354 K.DKDLTADR.T
2.5 6.7e+002 0.0532 K.QDPAMVTR.R
1.5 8.5e+002 0.0354 K.DKDVNAGSK.G
Top scoring peptide matches to query 21
Score greater than 38 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
45.3 0.035 -0.0288 1 CH60_HUMAN VTDALNATR
22.9 6.1 -0.0288 R.VTNDDKLR.I
22.9 6.1 -0.0838 M.VTNMVKLR.N
22.1 7.3 -0.0288 K.LSNPSSSLR.S
18.7 16 -0.0328 R.AEDFLPLR.L
18.4 17 -0.0651 K.KADSSALLR.T
16.2 29 -0.0586 K.VVGNMRIR.S
15.2 36 -0.0400 R.SIGEARATR.Q
14.1 47 -0.0652 K.DTLGLGKTR.R
13.7 51 -0.0288 K.VTDDAGKVR.N
Top scoring peptide matches to query 22
Score greater than 22 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
14.4 38 -0.1148 R.ITVSTSGLVPK.I
8.7 1.4e+002 -0.0056 ENVIPADSEK
7.7 1.8e+002 -0.0784 ELQSLGLDVK
7.4 1.9e+002 -0.0784 K.KELDILNEK.M
7.3 1.9e+002 -0.1148 R.ITVSTSGVIPK.M
7.0 2.1e+002 -0.1148 K.ELLGIGTGTLK.R
6.6 2.3e+002 -0.1082 K.ILMQVTRPK.M
5.2 3.1e+002 -0.1148 K.TVIITALNEK.I
4.5 3.7e+002 -0.0532 K.EQTPGSKQVK.A
4.5 3.7e+002 -0.1148 R.SLTISTVGVPK.K
Top scoring peptide matches to query 23
Score greater than 23 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
12.0 65 0.0132 K.QLLMVAGVDR.Y
10.0 1e+002 0.0319 R.AVLETAQNQK.N
7.3 2e+002 0.0860 -.MTHQAAEVAK.R
5.9 2.7e+002 0.0384 -.MAARAPELAR.S
5.0 3.2e+002 -0.0119 -.MSLLTLPQAK.L
4.1 4e+002 0.0748 -.MSATDPRPAR.T
4.1 4e+002 0.1765 R.MSAYNMDNR.D
4.1 4e+002 0.0959 -.MASVQWHSR.S
4.1 4e+002 -0.0119 -.MASVVPLKEK.K
3.8 4.3e+002 0.0748 M.QHMTTAQIR.Q
Top scoring peptide matches to query 24
Score greater than 32 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
56.5 0.0022 -0.0447 1 CH60_HUMAN K.EIGNIISDAMK.K
16.1 24 -0.1479 K.AGNGIIRKPHK.K
16.0 25 -0.0778 K.EIGQVFAEAVK.D
16.0 25 -0.1043 K.ELQRFAIWK.Y
15.3 29 -0.0924 K.RAEAVLSLMGK.N
15.2 30 -0.0930 R.ELFHGLYALK.K
13.3 47 -0.1141 K.GLNEILIYQK.K
13.3 47 -0.0811 K.TQLALLEQMK.K
13.1 49 -0.0560 K.ELQRGMDLTK.R
12.9 51 -0.0203 R.ELAYPEHGFK.V
Top scoring peptide matches to query 25
Score greater than 26 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
59.5 0.001 -0.0668 1 CH60_HUMAN K.EIGNIISDAMK.K
10.1 88 -0.1726 M.LKATISADIFK.D
9.7 97 -0.1144 ETIVRVTGGMK
9.6 99 -0.1362 K.LEGLLNYISGK.L
9.5 1e+002 -0.0304 K.ELQEQIDGMK.L
9.4 1e+002 -0.0998 K.IEGVQLTFDGK.A
8.3 1.4e+002 -0.0780 K.ELQRGMDLTK.R
8.2 1.4e+002 -0.1699 K.QLGIDIHRVR.W
8.0 1.4e+002 -0.1032 R.KLVADGTMDLK.I
7.1 1.8e+002 -0.0820 R.QLGMPLDFSAK.A
Top scoring peptide matches to query 26
Score greater than 37 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
73.2 4.6e-005 -0.0455 1 CH60_HUMAN K.NAGVEGSLIVEK.I
20.6 8.4 -0.0502 K.GQRAMIAPVTR.I
14.8 32 -0.0277 R.NQQEVMLIPK.L
14.8 32 0.0049 K.NARPDLSSAER.V
13.8 40 -0.0706 K.LEVEEIVKEK.E
12.2 58 -0.0455 K.ANGVDLVTALDK.Q
11.1 75 -0.0567 K.EIAKTQGEIAR.I
11.1 75 -0.0454 K.NENIKELLDK.I
10.9 79 -0.0641 K.INIKEMNLPK.H
10.7 82 -0.0819 R.LEVVTEGVLTR.M
Top scoring peptide matches to query 27
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
80.6 8.5e-006 -0.0316 1 CH60_HUMAN K.VGGTSDVEVNEK.K
41.7 0.066 -0.0316 VGGSSEVEVNEK
25.2 3 -0.0979 R.VGGMVVEGSVKR.D
17.6 17 -0.0801 R.VGGMVMPGSVKR.D
17.6 17 -0.0437 R.VGGMVMPGSVQR.D
17.1 19 -0.1043 K.VSKSVSAADIEK.Y
17.1 19 -0.1043 K.VSKSVSAADLEK.Y
16.7 21 -0.1230 K.VNTLITMKGEK.K
16.7 21 -0.1196 R.VNTLQGTPIYK.L
16.7 21 -0.0581 R.VNTRDDSWLK.M
Top scoring peptide matches to query 28
Score greater than 18 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
7.2 1.6e+002 0.0277 KNVSVSQGPDPR
5.3 2.5e+002 0.0459 K.LKGQMMMLSTK.K
5.3 2.5e+002 0.0459 K.LKGQMMMLSTK.K
4.9 2.8e+002 0.0931 R.QVQADYMTATR.E
4.7 2.9e+002 -0.0815 K.LLVTVAADVARR.R
4.3 3.2e+002 -0.0814 K.AGNLAGLLTGLKR.G
4.3 3.2e+002 -0.0338 K.KIEPEAVLQTR.V
3.5 3.8e+002 0.0459 R.KMVMGSMIGGIK.E
3.2 4.1e+002 -0.0451 K.LILPTNRSDVR.L
2.9 4.4e+002 -0.0702 R.KIANELGLINAK.K
Top scoring peptide matches to query 29
Score greater than 17 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
7.9 1.4e+002 -0.0431 K.VVGVAGQGASALVR.G
3.7 3.7e+002 0.0032 R.LAAAVDQHFRR.L
1.7 5.8e+002 0.1280 -.MAQQQMTSSQK.A
Top scoring peptide matches to query 30
Score greater than 21 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
9.5 94 -0.1054 R.AQLLEINEKLR.E
7.9 1.4e+002 -0.1670 K.VTLIKSTIGAVPK.N
7.2 1.6e+002 -0.1055 R.TPLLVGVAKGESR.K
5.9 2.2e+002 -0.0731 K.EAILKYHPDIK.A
5.7 2.2e+002 -0.1418 R.ILSLQEQLKVR.L
5.7 2.3e+002 -0.0618 K.SILLDLAYAYGK.L
5.4 2.4e+002 -0.1418 R.TIVLQEIIGKGR.F
5.3 2.5e+002 -0.1306 LEALQSKLSLPK
5.3 2.5e+002 -0.1128 K.TVLQNIMLAPVK.V
5.1 2.6e+002 -0.0579 K.VVAVGEGALTPEGK.R
Top scoring peptide matches to query 31
Score greater than 39 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
64.4 0.00033 -0.0480 1 CH60_HUMAN TVIIEQSWGSPK
23.0 4.6 -0.0076 R.VVDLQESSQPSR.S
22.8 4.8 -0.1571 K.SIIIKQALPYAK.V
21.2 6.8 -0.0691 K.LEALEKENSALK.L
16.8 19 -0.0765 M.SLLLEPSPTMIK.E
15.8 24 -0.0327 K.SIIVIGDDEAANK.E
15.7 25 -0.0076 K.KALNENDGDLQK.A
15.4 26 -0.0804 K.TIVLQEGNSQKK.S
15.2 27 -0.0844 R.TVLWKVDDAVAK.S
14.5 33 -0.0375 K.VGGVGRMDQNIAK.Y
Top scoring peptide matches to query 32
Score greater than 13 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
1.2 6.2e+002 0.0752 K.DKAIGYTSCGNHR.D
Top scoring peptide matches to query 33
Score greater than 31 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
30.8 0.67 -0.0990 R.EASPLSSNKLILR.D
17.5 15 -0.0449 K.DRIGDPMIELIR.H
16.3 19 -0.0375 K.AEPQSELTRQIR.K
15.3 24 -0.1177 R.REVAILCELLLR.G
14.7 27 -0.0263 K.EAAGVVLDESGKPR.F
14.6 28 -0.0375 K.EAALAAQRAEIER.A
14.2 31 -0.0415 R.SLLAKYHVDEPR.E
13.2 39 -0.1103 R.ISLTVTRSNPALR.E
12.7 43 -0.0262 K.LEAAANEAEQIIR.E
12.4 47 -0.0449 R.VTAMKVPGGGEIPR.K
Top scoring peptide matches to query 34
Score greater than 37 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
64.5 0.00029 -0.0435 1 CH60_HUMAN R.GVMLAVDAVIAELK.K
20.7 6.9 -0.0295 R.ALMGAEAVRELLR.T
20.5 7.2 -0.0724 K.TSVRDIALEALIK.L
16.3 19 -0.0547 K.RPLSSMSPTIVLK.D
16.2 20 0.0181 R.RMLADEVEPQLK.G
13.8 34 -0.0296 R.RVLTTDPGMGIIR.H
13.8 34 -0.0547 K.RMLPSVILDSGIK.E
13.5 36 0.0116 K.VDANEEVEALIVK.S
13.0 40 -0.0109 R.ELSQVEGIERLR.F
11.4 59 -0.0659 R.LGVMIGDSVIIRR.A
Top scoring peptide matches to query 35
Score greater than 37 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
72.6 4.4e-005 -0.0327 1 CH60_HUMAN R.GVMLAVDAVIAELK.K
20.0 8.1 0.0288 R.RMLADEVEPQLK.G
18.5 11 -0.0253 R.EQLTEGVVIQKGK.D
15.1 25 0.0434 R.ELTKTYEEFLR.G
14.3 30 -0.0188 R.ALMGAEAVRELLR.T
14.1 31 -0.0188 R.RVLTTDPGMGIIR.H
13.7 34 -0.0440 K.RPLSSMSPTIVLK.D
13.2 39 -0.0406 K.GVVESTALVVWLR.R
13.2 39 -0.0617 K.TSVRDIALEALIK.L
Top scoring peptide matches to query 36
Score greater than 32 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
75.2 2.5e-005 -0.0455 1 CH60_HUMAN R.GVMLAVDAVIAELK.K
14.9 26 -0.0169 K.ETWAEELVALRK.F
13.9 33 0.0161 R.RMLADEVEPQLK.G
13.6 35 0.0049 K.IMEQAVREALER.V
13.6 35 -0.1109 K.TTLTAALTIVQGKK.F
12.7 44 -0.0567 K.MIVAAPRTTIDLK.T
12.6 45 -0.1009 K.RLATIFVARPSTL.-
12.3 49 -0.0567 K.LGIGMVDIKVVER.E
10.7 70 -0.0897 K.FLVAAPRTTIDLK.T
9.9 84 -0.0533 R.FLAKLAGITEPER.K
Top scoring peptide matches to query 37
Score greater than 30 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
72.6 4.5e-005 -0.0285 1 CH60_HUMAN R.GVMLAVDAVIAELK.K
13.4 37 0.0218 K.IMEQAVREALER.V
12.7 43 -0.0939 K.TTLTAALTIVQGKK.F
12.0 52 -0.0397 K.LGIGMVDIKVVER.E
11.1 64 -0.0224 R.RPSTYGIPRLER.I
9.7 87 0.0000 R.GVDAFLPEKALER.A
9.7 87 -0.0112 R.RFIADQLEISPR.D
9.7 87 0.0331 R.RMLADEVEPQLK.G
8.7 1.1e+002 0.0001 K.ETWAEELVALRK.F
8.6 1.1e+002 0.0106 R.RMELSVGAIQANR.T
Top scoring peptide matches to query 38
Score greater than 17 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
7.1 1.5e+002 0.0532 K.QSTMQRSAAGTSTR.S
3.9 3.2e+002 -0.0525 R.AAVLANESSPGVARR.S
3.8 3.3e+002 -0.0916 K.KIADLGIDVTPVEK.L
3.4 3.6e+002 0.1007 K.IDLLADMMWDDK.A
2.8 4.1e+002 -0.1392 K.LGQGINATLKLEIK.A
2.6 4.3e+002 -0.0969 K.WLKINLHGFLEK.L
2.0 4.9e+002 0.0679 R.AVADAEGHAEEDKR.K
2.0 4.9e+002 -0.0011 K.FKSLDIDSLNAMK.G
1.8 5.1e+002 -0.0817 R.QLPSLVYNPPTLR.D
1.8 5.2e+002 0.0275 K.KLNANQDQYEFK.A
Top scoring peptide matches to query 39
Score greater than 32 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
89.6 8.9e-007 -0.0349 1 CH60_HUMAN K.TLNDELEIIEGMK.F
89.6 8.9e-007 -0.0349 2 CH60_CAEEL K.TLNDELELIEGMK.F
14.0 32 0.0452 K.VNNDELLDEDNSK.F
13.5 36 -0.0098 R.NSQEAVDAILEGMK.W
10.7 68 -0.0428 R.NAQEELGEGLAFVK.D
10.5 71 0.0300 R.AKEDEPEGASWASK.Y
10.5 72 -0.0210 K.DMSINEEIERLR.H
9.5 90 -0.0428 R.QWELEKISTENK.K
8.8 1e+002 -0.0462 R.TLIDRDVDDIMAK.V
8.3 1.2e+002 -0.0713 R.DVEETNMITLLVK.L
Top scoring peptide matches to query 40
Score greater than 34 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
88.8 1e-006 -0.0662 1 CH60_HUMAN K.TLNDELEIIEGMK.F
88.8 1e-006 -0.0662 2 CH60_CAEEL K.TLNDELELIEGMK.F
15.7 21 -0.1581 R.VNSQSGKGGIAYVLK.N
13.8 32 -0.0411 R.NSQEAVDAILEGMK.W
9.3 89 -0.1655 K.MLDVNKQVIYIGK.A
8.7 1e+002 -0.0564 R.RGDAAPMALLEFVD.-
8.1 1.2e+002 -0.0523 K.DMSINEEIERLR.H
7.9 1.2e+002 -0.1217 K.ATRDEIFVELATR.A
7.3 1.4e+002 -0.1331 R.KLMAELPEWLYK.-
7.3 1.4e+002 -0.1006 K.WQEELQIYRQK.V
Top scoring peptide matches to query 41
Score greater than 14 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
1.9 4.1e+002 -0.0850 K.AGLELADSPVTPEMLGR.L
1.9 4.2e+002 -0.0962 K.DRVALNQEVMAPEATK.N
1.2 4.9e+002 -0.1027 R.AIAALDKVEVENEDQK.I
0.7 5.5e+002 -0.1292 K.EVAALITGQDVYSHLR.Y
0.6 5.6e+002 -0.1068 K.ITGLVDASLFSTQYEK.E
0.3 6e+002 0.0234 R.DMNLEPMAINSYMAR.I
0.2 6.2e+002 -0.1074 R.SLLKIDGVSNGSMSHAR.R
Top scoring peptide matches to query 42
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
Top scoring peptide matches to query 43
Score greater than 13 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
0.7 5.3e+002 0.0377 R.ISATCVPSAVQKWFAEK.Q
Top scoring peptide matches to query 44
Score greater than 13 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
0.8 4.2e+002 0.0798 R.LAARWLAEHPHAPSSVR.F
0.3 4.7e+002 0.0520 K.LLSWDSVFFIKNITSK.N
Top scoring peptide matches to query 45
Score greater than 30 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
101.5 4.3e-008 -0.1010 1 CH60_HUMAN K.ISSIQSIVPALEIANAHR.K
3.5 2.7e+002 -0.1197 R.TALLLGTGTLAAFNLMRR.L
2.1 3.8e+002 -0.0548 R.ATGGFTVGHAPLDARPPVR.S
2.0 3.8e+002 0.0881 R.EVLSFYADADGTYSPQR.Y
1.9 3.9e+002 -0.0469 K.YESLELCRPVLQQGRK.Q
1.2 4.6e+002 -0.1567 K.AEPLKPFIWLHVSILR.E
1.1 4.7e+002 0.0007 K.RILQGPPMDTLGFSNEK.S
0.6 5.2e+002 -0.0026 K.NVQVKEIAIPDLSCSMR.L
0.2 5.7e+002 -0.1131 M.WFYLVTLVGLYYLLR.W
Top scoring peptide matches to query 46
Score greater than 32 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
87.3 1.1e-006 -0.0127 1 CH60_HUMAN K.ISSIQSIVPALEIANAHR.K
7.2 1.1e+002 0.1539 K.LSENGDVFVNDAFGAAHR.A
6.6 1.2e+002 0.0778 K.LERTNLTQLMDHYLR.T
5.1 1.8e+002 0.0125 R.LRAEVDQHLQEALQLR.E
3.3 2.7e+002 0.0931 R.DGRSVAELMQAGAEVITR.A
3.3 2.7e+002 0.0931 R.DGRSVAELMQAGAEVLTR.A
3.1 2.8e+002 0.0414 K.YESLELCRPVLQQGRK.Q
Top scoring peptide matches to query 47
Score greater than 13 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
2.3 3.6e+002 0.0407 K.QTLQVFKYYLMDENGK.I
0.0 6e+002 -0.0168 K.KEIIAMNVDDLNVDLFK.G
Top scoring peptide matches to query 48
Score greater than 33 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
52.4 0.0031 -0.0087 1 CH60_HUMAN R.IQEIIEQLDVTTSEYEK.E
17.5 9.8 -0.1403 R.QLELLKNKPVDELLETR.Y
6.2 1.3e+002 -0.1555 K.QLELLEFQLSHVINKVK.E
4.9 1.8e+002 -0.1477 R.EQLIKEVEMIPLEIVVR.N
4.5 1.9e+002 -0.1079 R.LKELAGIQTQAFLIDSYK.E
3.9 2.2e+002 -0.0675 R.KLILQDASSDSAVITSSFR.G
1.5 3.9e+002 -0.0439 R.EALGIAPGAPPPWLFAMQR.Y
1.3 4.1e+002 0.0304 R.VTQIRQQIEDATSDYDR.E
0.4 5e+002 -0.0940 K.KLKPFLLDDHDTSQRPK.F
Top scoring peptide matches to query 49
Score greater than 17 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
5.5 1.6e+002 -0.1027 R.VEPPGDKTLKPGPGAHSPEK.V
4.1 2.2e+002 -0.0558 R.HQRLSGLMQTALEEQQR.S
3.0 2.9e+002 0.0109 R.KGSMISVMSSEGNADTPVSK.F
1.6 4e+002 -0.1101 R.YPATTLIIAGVRFMGESAK.I
1.1 4.5e+002 -0.0771 R.MIAGSAKQMGIAIEGVSAYK.E
Top scoring peptide matches to query 50
Score greater than 13 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
5.7 1.5e+002 0.0426 R.ALDEILEYQNYPVVCAKK.S
Top scoring peptide matches to query 51
Score greater than 24 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
115.8 1.4e-009 -0.0394 1 CH60_HUMAN ALMLQGVDLLADAVAVTMGPK
4.5 1.9e+002 -0.0836 K.ISLIEREFALSLMPPRPK.Y
2.7 2.9e+002 -0.0286 K.IDSILGFQNISVIHINDSK.N
0.7 4.6e+002 0.0368 R.AIEDTALLIMEAIGYNGFR.E
Top scoring peptide matches to query 52
Score greater than 20 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
71.8 3.7e-005 -0.0619 1 CH60_HUMAN ALMLQGVDLLADAVAVTMGPK
3.4 2.6e+002 0.0789 R.SNNMCIVGGFTQMIREGGAK.S
Top scoring peptide matches to query 53
Score greater than 16 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
1.4 4e+002 0.1342 R.ETFDMFGIIFTGHPCLER.I
Top scoring peptide matches to query 54
Score greater than 21 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
92.8 2.8e-007 -0.0412 1 CH60_HUMAN ALMLQGVDLLADAVAVTMGPK
3.0 2.7e+002 -0.0491 K.FPSLQVTAILIECGADVNVR.D
0.9 4.4e+002 0.0996 R.SNNMCIVGGFTQMIREGGAK.S
Top scoring peptide matches to query 55
Score greater than 13 indicates homology
Score greater than 39 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
Top scoring peptide matches to query 56
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
Top scoring peptide matches to query 57
Score greater than 21 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
6.5 1.1e+002 -0.1331 -.THPSVLPFIKQLIGTMDSVR.G
3.4 2.3e+002 0.0778 K.CMDHGFSVDQIEVFVEDLR.V
2.9 2.6e+002 0.0720 TLNANNMETLIECQSEGDIK
2.9 2.6e+002 -0.0531 K.NGLFNSVFLKTSLVDMYFK.C
2.7 2.7e+002 -0.0127 K.NFMAGQPDIQSALAAYVEAVK.T
Top scoring peptide matches to query 58
Score greater than 17 indicates homology
Score greater than 39 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
0.6 3.5e+002 0.1620 K.SEIENWDLGAGIYMSFYLLK.S
Top scoring peptide matches to query 59
Score greater than 29 indicates homology
Score greater than 38 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
0.4 3.6e+002 0.1765 R.KSSSLMTLDVDYVYMPENIK.E
Top scoring peptide matches to query 60
Score greater than 25 indicates homology
Score greater than 38 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
2.2 2.3e+002 0.1796 R.ELQEKSAEFMNAEIALQEER.A
1.6 2.7e+002 0.1462 R.NSAVICTLIANLMAFFMLLTM.-
Top scoring peptide matches to query 61
Score greater than 14 indicates homology
Score greater than 39 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
Top scoring peptide matches to query 62
Score greater than 15 indicates homology
Score greater than 38 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
Top scoring peptide matches to query 63
Score greater than 38 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
Top scoring peptide matches to query 64
Score greater than 23 indicates homology
Score greater than 38 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
Top scoring peptide matches to query 65
Score greater than 13 indicates homology
Score greater than 37 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
Top scoring peptide matches to query 66
Score greater than 37 indicates identity
Score    Expect     Delta  Hit  Protein Peptide
Top scoring peptide matches to query 67
Score greater than 35 indicates identity
Score    Expect     Delta  Hit  Protein Peptide